RetrogeneDB ID: | retro_mmul_885 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:86294924..86295271(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMED10 | ||
| Ensembl ID: | ENSMMUG00000015168 | ||
| Aliases: | None | ||
| Description: | transmembrane emp24-like trafficking protein 10 (yeast) [Source:HGNC Symbol;Acc:16998] |
| Percent Identity: | 77.78 % |
| Parental protein coverage: | 52.97 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | LALLLLFLLCPSLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITD-SAGHIL |
| LA.L.LF.L.PSLVL.ISFHLPINS.K.LREEIHKDLLV...YEIS.QS.GAG.L.SHL.ITD.SAGHIL | |
| Retrocopy | LAWLFLFPLNPSLVLTISFHLPINS*KYLREEIHKDLLVMSVYEISNQSRGAGSLHSHLRITD<SAGHIL |
| Parental | YSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVE |
| YSKEDATKGKF.FT.EDYDMFEV..ES..TG.I.DQ..ILDMKHGVE | |
| Retrocopy | YSKEDATKGKFTFTLEDYDMFEV*YESEETGKILDQFIILDMKHGVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 41 .68 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 41 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 22 .60 RPM |
| SRP007412_heart | 0 .00 RPM | 27 .74 RPM |
| SRP007412_kidney | 0 .00 RPM | 54 .93 RPM |
| SRP007412_liver | 0 .00 RPM | 69 .19 RPM |
| SRP007412_testis | 0 .04 RPM | 37 .84 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2701 |
| Pan troglodytes | retro_ptro_1823 |
| Callithrix jacchus | retro_cjac_1409 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000016899 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020627 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019851 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010607 | 1 retrocopy | |
| Homo sapiens | ENSG00000170348 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007453 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000017125 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000015168 | 2 retrocopies |
retro_mmul_2316, retro_mmul_885 ,
|
| Mus musculus | ENSMUSG00000021248 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016453 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004669 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029389 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006552 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007901 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000007392 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000003089 | 1 retrocopy |