RetrogeneDB ID: | retro_mmul_2573 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | X:44551415..44551907(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2212 | ||
| Ensembl ID: | ENSMMUG00000020149 | ||
| Aliases: | None | ||
| Description: | charged multivesicular body protein 5 [Source:RefSeq peptide;Acc:NP_001253497] |
| Percent Identity: | 90.24 % |
| Parental protein coverage: | 74.89 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK |
| .N..FGKA.PKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKAL.VLK | |
| Retrocopy | INQFFGKANPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALKVLK |
| Parental | QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME |
| .K.MYEQQ..NL.QQ.F.MEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQ.KIDQIEDLQDQLEDMME | |
| Retrocopy | *KWMYEQQQGNLEQQPFSMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQLKIDQIEDLQDQLEDMME |
| Parental | DANEIQEALSRSYGTPELDEDDLE |
| DANEIQEAL.RSYGTPEL.EDDL. | |
| Retrocopy | DANEIQEALIRSYGTPELVEDDLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 56 .14 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 47 .12 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 53 .47 RPM |
| SRP007412_heart | 0 .00 RPM | 31 .15 RPM |
| SRP007412_kidney | 0 .00 RPM | 59 .39 RPM |
| SRP007412_liver | 0 .04 RPM | 16 .47 RPM |
| SRP007412_testis | 0 .00 RPM | 31 .25 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4822 |
| Pan troglodytes | retro_ptro_3210 |
| Pongo abelii | retro_pabe_3750 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012672 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008104 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000003467 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000006280 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000001424 | 1 retrocopy | |
| Homo sapiens | ENSG00000086065 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000012113 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011045 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020149 | 1 retrocopy |
retro_mmul_2573 ,
|
| Monodelphis domestica | ENSMODG00000004012 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028419 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005158 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000000774 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000019137 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000020857 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008672 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000026573 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000003486 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010575 | 1 retrocopy |