RetrogeneDB ID: | retro_mmul_1914 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:142022837..142023172(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AKIRIN2 | ||
| Ensembl ID: | ENSMMUG00000002824 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.09 % |
| Parental protein coverage: | 56.16 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKER |
| K..QKRR..E.SFQQ.DPCCTSDA..HAFLL.G.ASPGTSSAASSPLKKEQPLFTL.QVGMICE.LLKER | |
| Retrocopy | KERQKRRYSEMSFQQIDPCCTSDA--HAFLLTGSASPGTSSAASSPLKKEQPLFTLWQVGMICEHLLKER |
| Parental | EEKVREEYEE-ILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
| EEKV.EEYEE.ILNTKLAEQY.A.VKFTHDQIMRRYGEQPASYVS | |
| Retrocopy | EEKVWEEYEE<ILNTKLAEQYVASVKFTHDQIMRRYGEQPASYVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 31 .15 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 39 .19 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 27 .70 RPM |
| SRP007412_heart | 0 .00 RPM | 19 .90 RPM |
| SRP007412_kidney | 0 .00 RPM | 20 .19 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .30 RPM |
| SRP007412_testis | 0 .00 RPM | 25 .41 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2991 |
| Pan troglodytes | retro_ptro_2023 |
| Gorilla gorilla | retro_ggor_2071 |
| Pongo abelii | retro_pabe_2477 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy | |
| Homo sapiens | ENSG00000135334 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy |
retro_mmul_1914 ,
|
| Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |