RetrogeneDB ID: | retro_mluc_2233 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430132:54973..55313(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLR3G | ||
| Ensembl ID: | ENSMLUG00000014954 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.34 % |
| Parental protein coverage: | 51.57 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | REMMPRKKFK-KAGPKSKKVNDTGKDTSLTNTADVL-KKIEELEKRGDGEKSDEENEEKEGSKEKSKEDE |
| .EM.PRKK.K.KAGPKSKK.NDTGKDTSL.NT..VL.KK.....K.GDG.K..EE.EE.EG.KEK.K.D. | |
| Retrocopy | QEMIPRKKYK>KAGPKSKKLNDTGKDTSLINTDNVL>KKLRNW-KTGDGGKFNEESEEQEGRKEKGKKDP |
| Parental | EEEEDDAAEQEEYDEEEQEEENDYINSYFDNGDDFI-VDSDDNMDEAT |
| ..EEDD..E.EEYDEEEQEEENDYI.SYFD.GDDF...DSDDNMDE.T | |
| Retrocopy | DHEEDDTGE-EEYDEEEQEEENDYIHSYFDTGDDFL<ADSDDNMDEVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006306 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010747 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008379 | 1 retrocopy | |
| Homo sapiens | ENSG00000113356 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000266 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014954 | 1 retrocopy |
retro_mluc_2233 ,
|
| Myotis lucifugus | ENSMLUG00000016931 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018972 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013749 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005560 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015624 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017068 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016260 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000008664 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002278 | 2 retrocopies |