RetrogeneDB ID: | retro_ggor_1119 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 14:73323891..73324318(-) | ||
| Located in intron of: | ENSGGOG00000009858 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLR3G | ||
| Ensembl ID: | ENSGGOG00000000266 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 90.91 % |
| Parental protein coverage: | 72.31 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKR |
| MA.NKG.GRAAYTFNIEAVGFSKG.KLPDVVLKPPPLFPDTDYKPVPLKTGEGE.YMLALKQELRETMKR | |
| Retrocopy | MAENKG*GRAAYTFNIEAVGFSKGKKLPDVVLKPPPLFPDTDYKPVPLKTGEGE*YMLALKQELRETMKR |
| Parental | MPYF-IETP-EERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTSLTNT |
| MPYF....P.EERQDIERYSKRY.KVYKEEWIPDWRRLPREMMP.NKCKKAGPKPKKAKD..KGTSLTNT | |
| Retrocopy | MPYF>LKHPHEERQDIERYSKRYVKVYKEEWIPDWRRLPREMMPINKCKKAGPKPKKAKDTSKGTSLTNT |
| Parental | ADV |
| ADV | |
| Retrocopy | ADV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .62 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .71 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .09 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .16 RPM |
| SRP007412_liver | 0 .08 RPM | 0 .18 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .35 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1454 |
| Pan troglodytes | retro_ptro_989 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006306 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010747 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008379 | 1 retrocopy | |
| Homo sapiens | ENSG00000113356 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000266 | 2 retrocopies |
retro_ggor_1119 , retro_ggor_1382,
|
| Myotis lucifugus | ENSMLUG00000014954 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018972 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013749 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005560 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015624 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017068 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016260 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000008664 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002278 | 2 retrocopies |