RetrogeneDB ID: | retro_mluc_2203 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430098:539973..540211(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMLUG00000023209 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBA52 | ||
| Ensembl ID: | ENSMLUG00000029594 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.95 % |
| Parental protein coverage: | 62.99 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG-RTLSDYNIQKESTLHW |
| .QI.VKTLTGKTITLEVEPS...ENVKAKI.DKEGIPPD....IFA.K.LED...TL...NIQKESTLH. | |
| Retrocopy | VQISVKTLTGKTITLEVEPSNATENVKAKIRDKEGIPPDWKHVIFASKWLEDA<HTLLQHNIQKESTLHL |
| Parental | VLRL-RGGIIEP |
| V..L..GGIIEP | |
| Retrocopy | VFHL<VGGIIEP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |