RetrogeneDB ID: | retro_mdom_525 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:153377524..153377769(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA5 | ||
| Ensembl ID: | ENSMODG00000015384 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 [Source:HGNC Symbol;Acc:7688] |
| Percent Identity: | 63.86 % |
| Parental protein coverage: | 70.69 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LQLMPANAAYRKYTEQITNERMNMVKEETDLQKLEDQLQSGQLEE-VILQAENELSLARKMLIWKPWEPL |
| L.......AYRKYTEQITNER.N..K..T.LQK..DQ.Q.G..EE..ILQ.ENELSLARKML.WKP.EPL | |
| Retrocopy | LSRLCSQIAYRKYTEQITNERLNTAKQGTGLQKSKDQIQDGKIEE<MILQTENELSLARKMLTWKPLEPL |
| Parental | LEEPPANQWKWPL |
| .E...A..WKWPL | |
| Retrocopy | EEVLVAKLWKWPL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004512 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000009334 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000025112 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017449 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027125 | 5 retrocopies | |
| Homo sapiens | ENSG00000128609 | 10 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022922 | 9 retrocopies | |
| Loxodonta africana | ENSLAFG00000030971 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015384 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006811 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000023089 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000033137 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000017956 | 10 retrocopies | |
| Pan troglodytes | ENSPTRG00000019637 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000005698 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000016607 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000027404 | 1 retrocopy |