RetrogeneDB ID: | retro_itri_1363 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393457.1:589019..589314(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPDPF | ||
| Ensembl ID: | ENSSTOG00000007808 | ||
| Aliases: | None | ||
| Description: | pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) [Source:HGNC Symbol;Acc:16142] |
| Percent Identity: | 55.56 % |
| Parental protein coverage: | 85.96 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAAIPSSGSLVATHDYYRRRLGSASSNSSCGSAEYPG-EAIPHHPGLPKADPGHWWASFFFGKSTLPFMA |
| ..A.PSSGS.VA...Y....LGS..SNSS.GSA.Y.G.E..P.H.GLP.AD.GHWWASFF..K.TL.FM. | |
| Retrocopy | LEAVPSSGSPVAILSYHLCHLGSPASNSS*GSAKYSG>ETTPQHLGLPEADLGHWWASFFVRKFTLQFMV |
| Parental | TVVESPEHSESTQASTSMVTSGLAPETTK |
| .V...P.HSE..QA..SM.T..LA.E... | |
| Retrocopy | KVLKPPKHSEFSQAFRSMLTYNLAQEAAR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000031800 | 7 retrocopies | |
| Equus caballus | ENSECAG00000009413 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024386 | 14 retrocopies | |
| Homo sapiens | ENSG00000125534 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000002835 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000026496 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006064 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000016871 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008301 | 12 retrocopies | |
| Mus musculus | ENSMUSG00000016344 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010068 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008810 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000013739 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012722 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018338 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000007808 | 1 retrocopy |
retro_itri_1363 ,
|