RetrogeneDB ID: | retro_ggor_929 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 13:20887505..20887834(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PLA2G12A | ||
| Ensembl ID: | ENSGGOG00000001082 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.17 % |
| Parental protein coverage: | 57.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | PFPRYGYKPSP-PNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQY-CLSKICRDVQ |
| PFP...YKPS..PNG.GSPL..VHLNIGI.S.T.CCN..DRCYET.GKSKN...E.FQY.CL..IC..VQ | |
| Retrocopy | PFPHCNYKPSC<PNGRGSPLSRVHLNIGIASQTECCNYCDRCYETGGKSKNNWEEKFQYYCLFNICQNVQ |
| Parental | KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRC |
| KTLGL.QHVQACETT..LLFDSV.HLGCKP.LDSQ....RC | |
| Retrocopy | KTLGLAQHVQACETTMQLLFDSVRHLGCKPHLDSQWVPYRC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .48 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .89 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .91 RPM |
| SRP007412_kidney | 0 .08 RPM | 10 .67 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .83 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .15 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_817 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015230 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016169 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000016573 | 7 retrocopies | |
| Homo sapiens | ENSG00000123739 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001082 | 2 retrocopies |
retro_ggor_242, retro_ggor_929 ,
|
| Loxodonta africana | ENSLAFG00000000852 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008637 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000027999 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004686 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000014505 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000016362 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009139 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000004756 | 4 retrocopies | |
| Vicugna pacos | ENSVPAG00000009842 | 1 retrocopy |