RetrogeneDB ID: | retro_ggor_2739 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 8:79171227..79171464(-) | ||
| Located in intron of: | ENSGGOG00000008615 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CKS1B | ||
| Ensembl ID: | ENSGGOG00000013419 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 97.47 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
| .SHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR | |
| Retrocopy | ISHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
| Parental | RPLPKKPKK |
| RPLP.KPKK | |
| Retrocopy | RPLPEKPKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .79 RPM |
| SRP007412_cerebellum | 0 .20 RPM | 1 .34 RPM |
| SRP007412_heart | 0 .06 RPM | 1 .69 RPM |
| SRP007412_kidney | 0 .04 RPM | 5 .48 RPM |
| SRP007412_liver | 0 .13 RPM | 9 .13 RPM |
| SRP007412_testis | 0 .00 RPM | 23 .52 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_2769 |