RetrogeneDB ID: | retro_fcat_984 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B4:102364299..102364738(+) | ||
| Located in intron of: | ENSFCAG00000027470 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAB5A | ||
| Ensembl ID: | ENSFCAG00000004455 | ||
| Aliases: | None | ||
| Description: | RAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:9783] |
| Percent Identity: | 80.67 % |
| Parental protein coverage: | 61.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | VCLDDTTVKFEIWDTAGQERYHSLAP-MYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIAL |
| .CLDDTTV.F..WDTAGQE.YHSLAP.MYYR.AQAAIVV.DIT.E.S..RAKNW.KELQ.QA.P..VIAL | |
| Retrocopy | LCLDDTTVEFDVWDTAGQECYHSLAP<MYYREAQAAIVVCDITDESS-GRAKNWAKELQTQANPSNVIAL |
| Parental | SGNK-ADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGV |
| SGN..A.LAN.RAVDFQEAQSY.DDNSLLFMETSAKTSMNVNEIFMA.AK.LPKNEPQ.PGANSARG..V | |
| Retrocopy | SGNR<ANLANERAVDFQEAQSYEDDNSLLFMETSAKTSMNVNEIFMAVAKMLPKNEPQKPGANSARGKRV |
| Parental | DLTEPTQPTR |
| DLTEP.QP.R | |
| Retrocopy | DLTEPMQPIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .46 RPM | 33 .74 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .50 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .21 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000954 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000046385 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003731 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000005322 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000012429 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004455 | 2 retrocopies |
retro_fcat_1349, retro_fcat_984 ,
|
| Homo sapiens | ENSG00000144566 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015981 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000008321 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006992 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000014793 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000017831 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003434 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012200 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014074 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000014682 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000026229 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007642 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001374 | 1 retrocopy |