RetrogeneDB ID: | retro_fcat_2019 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | X:110511010..110511418(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSFCAG00000029749 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYL12B | ||
| Ensembl ID: | ENSFCAG00000022871 | ||
| Aliases: | None | ||
| Description: | myosin, light chain 12B, regulatory [Source:HGNC Symbol;Acc:29827] |
| Percent Identity: | 63.83 % |
| Parental protein coverage: | 80.81 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | KAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDML-ASLGKNPTDAYLDAM |
| K.....T.....R.....FA.F.Q.QI.EFKE.F.MID.N.DGFI.K..L.DML..SLGKNPTDAYLDAM | |
| Retrocopy | KRQRPRTPRSGLRTQHPMFAVFGQPQI*EFKEVFDMIDPNTDGFI-KDNLRDML<SSLGKNPTDAYLDAM |
| Parental | MNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRE-LLTTMGDRFTDEEVDEL |
| MN.APGPINFT..L.MFGEKL.GTDPED.IRNA.ACFDE.AT.TI.E.YLR..L.TT.GD.....EV..L | |
| Retrocopy | MNDAPGPINFTSLLMMFGEKLDGTDPED-IRNASACFDEKATNTI*EHYLRA>LTTT-GD*SPNKEVHKL |
| Parental | Y |
| Y | |
| Retrocopy | Y |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 62 .21 RPM |
| SRP017611_kidney | 0 .00 RPM | 133 .15 RPM |
| SRP017611_liver | 0 .00 RPM | 44 .99 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012665 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000032168 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007004 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000007562 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006985 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022871 | 1 retrocopy |
retro_fcat_2019 ,
|
| Homo sapiens | ENSG00000118680 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004051 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000005189 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000021464 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000005011 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000034868 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006907 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000029777 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000009032 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000009836 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015733 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010418 | 9 retrocopies |