RetrogeneDB ID: | retro_amel_1847 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL194784.1:2311..2745(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYL12B | ||
| Ensembl ID: | ENSAMEG00000012665 | ||
| Aliases: | None | ||
| Description: | myosin, light chain 12B, regulatory [Source:HGNC Symbol;Acc:29827] |
| Percent Identity: | 59.59 % |
| Parental protein coverage: | 84.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPT-DAY |
| .....A.....K......T.NV.A.F.Q.QI.EFKE.FNM..QNR.GFI.K..LH..L.SLGKN.T..AY | |
| Retrocopy | LRNETASMWSKKANTGNVTFNVLAVFGQPQI*EFKEVFNMTAQNRAGFISKDNLHARLTSLGKNRT<AAY |
| Parental | LEAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEV |
| L.A.M..A.GP.NFT..L..F..KLNGTDPE.VIRNAF.CFDEEATG.I.E.YLRELLTTM.D.F.D.EV | |
| Retrocopy | LNASMKDALGPVNFTLLLMTFAKKLNGTDPEAVIRNAFTCFDEEATGSIREHYLRELLTTMRDWFPDKEV |
| Parental | DELYRE |
| .EL.R. | |
| Retrocopy | HELCRD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012665 | 1 retrocopy |
retro_amel_1847 ,
|
| Canis familiaris | ENSCAFG00000032168 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007004 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000007562 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006985 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022871 | 1 retrocopy | |
| Homo sapiens | ENSG00000118680 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004051 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000005189 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000021464 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000005011 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000034868 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006907 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000029777 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000009032 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000009836 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015733 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010418 | 9 retrocopies |