RetrogeneDB ID: | retro_fcat_1458 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | D1:80628130..80628527(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TAF10 | ||
| Ensembl ID: | ENSFCAG00000015390 | ||
| Aliases: | None | ||
| Description: | TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa [Source:HGNC Symbol;Acc:11543] |
| Percent Identity: | 69.63 % |
| Parental protein coverage: | 61.03 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | EGAMSNGVYVLPSAANGDVKPVVSST-PLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISL |
| EGA.S.GVYVL.S..NG.VK.V.S...P..DF.MQLEDYTP.IPDAV..YYL..AG.E..DP.II.LISL | |
| Retrocopy | EGAGSTGVYVLWSRTNGEVKAVMSRS<PVIDFSMQLEDYTPMIPDAVPSYYLHGAGSETLDPGIIQLISL |
| Parental | --AAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKY-TLTMEDLTPALS-EYGINVKKPHYFT |
| ..AAQK.ISDIA.DALQH.KMK.TAS.SS.S.SKDRK..TLTMEDLTPA.S..YGI.VK.PH.FT | |
| Retrocopy | AAAAQKSISDIASDALQH*KMKDTASSSSGSNSKDRKQ>TLTMEDLTPAVS>DYGIDVKRPH*FT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 20 .43 RPM |
| SRP017611_kidney | 0 .10 RPM | 33 .39 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .75 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000006498 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000814 | 1 retrocopy | |
| Equus caballus | ENSECAG00000007794 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000008412 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000008886 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015390 | 1 retrocopy |
retro_fcat_1458 ,
|
| Macropus eugenii | ENSMEUG00000008216 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024459 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007743 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000043866 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004894 | 1 retrocopy |