RetrogeneDB ID: | retro_ecab_525 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 2:101381817..101382114(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TAF10 | ||
| Ensembl ID: | ENSECAG00000007794 | ||
| Aliases: | None | ||
| Description: | TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa [Source:HGNC Symbol;Acc:11543] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 98.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIAN--DALQHCKMKGTASGSSRSKSK |
| QLED.TPTIPD.VTGY.LN.AGF.ASDP.I...I.L.AQKFISDIAN..D.L.HCK.KGTAS.SS.SK.. | |
| Retrocopy | QLEDCTPTIPDRVTGYSLNHAGFGASDPDITQFIPLTAQKFISDIANNVDVLWHCKRKGTASSSS*SKKR |
| Parental | DRKYTLTMEDLTPALSEYGINVKKPHYFT |
| D..YTL..EDLT..LS.Y.I...KP..FT | |
| Retrocopy | DHRYTLSIEDLTSTLSKYDISINKPQHFT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 19 .48 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 26 .33 RPM |
| SRP021940_embryo | 0 .00 RPM | 28 .08 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 25 .16 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 27 .01 RPM |
| SRP021940_testis | 0 .00 RPM | 69 .38 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016278 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000006498 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000814 | 1 retrocopy | |
| Equus caballus | ENSECAG00000007794 | 1 retrocopy |
retro_ecab_525 ,
|
| Erinaceus europaeus | ENSEEUG00000008412 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000008886 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015390 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000029330 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000008216 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024459 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007743 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000043866 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004894 | 1 retrocopy |