RetrogeneDB ID: | retro_fcat_1159 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:10542451..10542681(-) | ||
| Located in intron of: | ENSFCAG00000016267 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBA52 | ||
| Ensembl ID: | ENSFCAG00000009745 | ||
| Aliases: | UBA52, CEP52, UBCEP2 | ||
| Description: | Ubiquitin-60S ribosomal protein L40 Ubiquitin 60S ribosomal protein L40 [Source:UniProtKB/Swiss-Prot;Acc:P63052] |
| Percent Identity: | 56.96 % |
| Parental protein coverage: | 59.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GRTLSD-YNIQKESTLHLVLRL-RGGIIEPSLRQLAQKYNCDKM-ICRKCYARLHPRAVNCRKKKCGHTN |
| G..L.D.YN.Q..S.........RGG...PSLRQ.AQKYNC.K...CR...ARLHPRA.NC..KKCGH.N | |
| Retrocopy | GKQLEDGYNTQEGSAXXXXXXXXRGGTLQPSLRQPAQKYNCNKI<TCRGSSARLHPRAANCH-KKCGHSN |
| Parental | NLRPKKKVK |
| .LRPK.KV. | |
| Retrocopy | DLRPKRKVR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 56 .81 RPM |
| SRP017611_kidney | 0 .00 RPM | 162 .11 RPM |
| SRP017611_liver | 0 .00 RPM | 106 .65 RPM |