RetrogeneDB ID: | retro_fcat_108 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:7652592..7652808(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSFCAG00000029082 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000015176 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.83 % |
| Parental protein coverage: | 82.56 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KERYLQLKKKLEDEFPGCLDICGEGTPQATGFFEVMVGGKLVHSKKRGDGYVDTESKFLKLVAAIKAALA |
| K..YLQ..KKLEDE.P..LDIC..GTPQ.TG.FEVMV.GKL.HSKK.GDGY.D.ESKF.KLV.AI.A.LA | |
| Retrocopy | KSKYLQ-HKKLEDELPRSLDICSKGTPQTTG-FEVMVAGKLFHSKKGGDGYTDMESKFPKLVGAIRATLA |
| Parental | Q |
| Q | |
| Retrocopy | Q |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 88 .26 RPM |
| SRP017611_kidney | 0 .00 RPM | 28 .13 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008203 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004074 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies | |
| Felis catus | ENSFCAG00000015176 | 2 retrocopies |
retro_fcat_108 , retro_fcat_186,
|
| Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |