RetrogeneDB ID: | retro_cfam_1368 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 3:26566442..26566643(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SEPW1 | ||
| Ensembl ID: | ENSCAFG00000004074 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris selenoprotein W, 1 (SEPW1), mRNA. [Source:RefSeq mRNA;Acc:NM_001115012] |
| Percent Identity: | 71.64 % |
| Parental protein coverage: | 91.78 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | LQLKKKLEDEFPGCLDICGEGTPQATGFFEVTVAGKLVHSKKRGDGYVDTESKFLRLVAAIKTALAQ |
| L.LKKKLEDE.PGCLDI.G..TPQAT...EV.VAG.LVHSK..GDGY.D.ESK.L.LVA.IK..LAQ | |
| Retrocopy | LKLKKKLEDESPGCLDI*GKRTPQATSLSEVMVAGMLVHSKNTGDGYMDMESKLLKLVAEIKATLAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 153 .55 RPM |
| SRP017611_brain | 0 .08 RPM | 203 .01 RPM |
| SRP017611_kidney | 0 .00 RPM | 79 .44 RPM |
| SRP017611_liver | 0 .07 RPM | 26 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008203 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004074 | 1 retrocopy |
retro_cfam_1368 ,
|
| Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies | |
| Felis catus | ENSFCAG00000015176 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |