RetrogeneDB ID: | retro_chof_1486 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_30557:7347..7568(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCHOG00000000940 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCHOG00000013206 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.33 % |
| Parental protein coverage: | 98.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | YKPKYVQLKKKLEDEFPGCLDISGEGT-PQ-TTGFFEVMVAGKLVHSKKKGDGFVDTESKFLRLVAAIKA |
| YKPKYVQLKKKLEDEFP.CLDIS.EGT.P..TT.FFEVMVAGKLVHSKKKG.GFVDTE.KFL..VAAIKA | |
| Retrocopy | YKPKYVQLKKKLEDEFPECLDISSEGTSPK<TTRFFEVMVAGKLVHSKKKGNGFVDTEGKFLKPVAAIKA |
| Parental | ALAQG |
| .LAQG | |
| Retrocopy | ILAQG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008203 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004074 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies |
retro_chof_1486 , retro_chof_61,
|
| Felis catus | ENSFCAG00000015176 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |