RetrogeneDB ID: | retro_ecab_783 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 4:35011541..35011832(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTP4A1 | ||
| Ensembl ID: | ENSECAG00000022483 | ||
| Aliases: | None | ||
| Description: | protein tyrosine phosphatase type IVA, member 1 [Source:HGNC Symbol;Acc:9634] |
| Percent Identity: | 56.0 % |
| Parental protein coverage: | 57.8 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | APPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNS |
| A.PSNQ.VDDWL.L...K..............AGL.RA..LVALALIEGGM.YEDAV.F.RQKR...F.S | |
| Retrocopy | ALPSNQTVDDWLCL--VKMKFLKNLALYQSHIAGLRRALMLVALALIEGGMTYEDAVKFVRQKRSRTFKS |
| Parental | KQLLYLEKYRPKMRLRFKDSNGHRNNCCVQ |
| .QLLYLE.Y.PK..L...D...H.N.CC.Q | |
| Retrocopy | RQLLYLE-YCPKIQLHCIDTSSHGNYCCCQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 17 .35 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 22 .59 RPM |
| SRP021940_embryo | 0 .03 RPM | 45 .54 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 52 .97 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 14 .47 RPM |
| SRP021940_testis | 0 .00 RPM | 92 .27 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_1720 |
| Canis familiaris | retro_cfam_593 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002275 | 3 retrocopies | |
| Equus caballus | ENSECAG00000022483 | 6 retrocopies | |
| Echinops telfairi | ENSETEG00000008183 | 6 retrocopies | |
| Latimeria chalumnae | ENSLACG00000007183 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006572 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001162 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002777 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000018701 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000440 | 6 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006311 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000004938 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000016743 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015225 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011771 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000046370 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000009956 | 14 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004129 | 6 retrocopies | |
| Vicugna pacos | ENSVPAG00000004277 | 9 retrocopies |