RetrogeneDB ID: | retro_ecab_353 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 15:80421086..80421323(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UFM1 | ||
| Ensembl ID: | ENSECAG00000014564 | ||
| Aliases: | None | ||
| Description: | ubiquitin-fold modifier 1 [Source:HGNC Symbol;Acc:20597] |
| Percent Identity: | 61.45 % |
| Parental protein coverage: | 94.12 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | FKITLTSD-PRLPYKVLSVPEGTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGS-E |
| FKITL..D.P.L.YK.LS.PE.TPFTAVLKFAA.EF.VP.AT.A.ITN.GI.INP.QT....FLK..S.. | |
| Retrocopy | FKITLMMD<PWLLYKELSFPESTPFTAVLKFAAAEFEVPPATTAVITNNGIEINPEQTTRDIFLKYVS<S |
| Parental | LRIIPR-DRVGSC |
| ..I.P.....GSC | |
| Retrocopy | VQIVPK<NNTGSC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 3 .66 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 5 .76 RPM |
| SRP021940_embryo | 0 .00 RPM | 11 .48 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 9 .00 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 6 .92 RPM |
| SRP021940_testis | 0 .00 RPM | 7 .67 RPM |