RetrogeneDB ID: | retro_ecab_1047 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | Un0613:3213..3453(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS13 | ||
| Ensembl ID: | ENSECAG00000014928 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S13 [Source:HGNC Symbol;Acc:10386] |
| Percent Identity: | 66.25 % |
| Parental protein coverage: | 52.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNK |
| MG....PGK.LSQ.ALP...S.PTWLK..SDD.KE..YKLA.KGLTPSQ..V.LR.SHG..QV.FV.GNK | |
| Retrocopy | MGHTYVPGKDLSQ*ALPLCHSIPTWLKMMSDDTKEHFYKLANKGLTPSQADVVLRNSHGTEQVCFVRGNK |
| Parental | ILRILKSKGL |
| .LRIL..KGL | |
| Retrocopy | TLRILQYKGL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 562 .67 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 255 .77 RPM |
| SRP021940_embryo | 0 .00 RPM | 354 .97 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 260 .67 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 341 .42 RPM |
| SRP021940_testis | 0 .00 RPM | 157 .43 RPM |