RetrogeneDB ID: | retro_dnov_433 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_4650:231232..231453(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RBX1 | ||
| Ensembl ID: | ENSDNOG00000007595 | ||
| Aliases: | None | ||
| Description: | ring-box 1, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:9928] |
| Percent Identity: | 80.52 % |
| Parental protein coverage: | 74.51 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | WNAVLWWNADCICRNHIMDLRIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWE |
| WN.V.......ICRNHIMDL.IECQANQ.SATSEECTVAWGVCNHAFHFHCIS.WLKT.QVCPL.N.EWE | |
| Retrocopy | WNIVV--DNCAICRNHIMDLCIECQANQVSATSEECTVAWGVCNHAFHFHCISCWLKTQQVCPLVNTEWE |
| Parental | F-QKYGH |
| F.QKYGH | |
| Retrocopy | F<QKYGH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 3 .69 RPM | 35 .78 RPM |
| SRP012922_cerebellum | 6 .19 RPM | 68 .73 RPM |
| SRP012922_heart | 3 .02 RPM | 35 .73 RPM |
| SRP012922_kidney | 4 .38 RPM | 81 .59 RPM |
| SRP012922_liver | 2 .79 RPM | 25 .39 RPM |
| SRP012922_lung | 4 .73 RPM | 75 .14 RPM |
| SRP012922_quadricep_muscle | 2 .94 RPM | 32 .37 RPM |
| SRP012922_spleen | 4 .81 RPM | 53 .34 RPM |