RetrogeneDB ID: | retro_dnov_2335 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_65333:8845..9293(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | THOC7 | ||
| Ensembl ID: | ENSDNOG00000005917 | ||
| Aliases: | None | ||
| Description: | THO complex 7 homolog (Drosophila) [Source:HGNC Symbol;Acc:29874] |
| Percent Identity: | 73.33 % |
| Parental protein coverage: | 73.04 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKI |
| LVKSFI.WCNSGSQE.GY.QYQ.MLSTLSQCEFSM.KTLLV.D.NLRE.ENY.KIYKEIEC.I.GAHE.I | |
| Retrocopy | LVKSFIQWCNSGSQEQGYRQYQSMLSTLSQCEFSMHKTLLVNDRNLREWENYKKIYKEIECNIIGAHEQI |
| Parental | AECKKQILQAKRI-RKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFH |
| AECKK..LQAK.....N.QEYD...KVIQH.P..HE.LKELE.LGKELEHLS.IKES.E...ELR.KQF. | |
| Retrocopy | AECKKELLQAK*L>EINHQEYDVWTKVIQHYPHEHEALKELEPLGKELEHLSQIKESFEVTIELRWKQFP |
| Parental | VLLSTIHELQ |
| .LLS.I...Q | |
| Retrocopy | MLLSSIKQHQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 40 .06 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 39 .32 RPM |
| SRP012922_heart | 0 .00 RPM | 16 .47 RPM |
| SRP012922_kidney | 0 .00 RPM | 29 .30 RPM |
| SRP012922_liver | 0 .00 RPM | 16 .72 RPM |
| SRP012922_lung | 0 .00 RPM | 49 .02 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 21 .46 RPM |
| SRP012922_spleen | 0 .00 RPM | 32 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012170 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000034899 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007930 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005917 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000001987 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012060 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000021860 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024865 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000013894 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011491 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007069 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000013618 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000010083 | 1 retrocopy |