RetrogeneDB ID: | retro_cpor_782 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_28:20656680..20657063(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LYPLA1 | ||
| Ensembl ID: | ENSCPOG00000022715 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.23 % |
| Parental protein coverage: | 62.32 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VIFLHGLGDTGHGWAEAFAGIRSS-HIKYICPHAPVMPVTLNMNMAMPSWFDIIGLSPDAHEDEPGIKRA |
| VIFLHGLG.T.HGWAEAFAGIRSS..IKY.CP..PV....LNMNMA.PSWFD.IGLSP..HED.PGI.RA | |
| Retrocopy | VIFLHGLGGTRHGWAEAFAGIRSS<SIKYTCPPVPVTLAALNMNMAVPSWFDLIGLSPESHEDQPGI*RA |
| Parental | AESVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASF |
| AE.VKA..DQEVKNG.PSNRII.GGF.....L.LYT....Q....GVT.LSCWLPL...F | |
| Retrocopy | AENVKAARDQEVKNGFPSNRIIWGGFLRM-ELNLYTLH*PQSRHWGVTTLSCWLPLLLHF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 6 .67 RPM |
| SRP017611_kidney | 0 .00 RPM | 50 .77 RPM |
| SRP017611_liver | 0 .00 RPM | 51 .45 RPM |
| SRP040447_lung | 0 .00 RPM | 19 .39 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 9 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000006978 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011562 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000022715 | 3 retrocopies |
retro_cpor_142, retro_cpor_549, retro_cpor_782 ,
|
| Dipodomys ordii | ENSDORG00000001479 | 1 retrocopy | |
| Equus caballus | ENSECAG00000016530 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001727 | 2 retrocopies | |
| Homo sapiens | ENSG00000120992 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008208 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013157 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001027 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006751 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000018590 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005246 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008320 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012350 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011836 | 3 retrocopies |