RetrogeneDB ID: | retro_cjac_575 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:82898097..82898541(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000022901 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | WBP2 | ||
| Ensembl ID: | ENSCJAG00000037619 | ||
| Aliases: | None | ||
| Description: | WW domain binding protein 2 [Source:HGNC Symbol;Acc:12738] |
| Percent Identity: | 93.92 % |
| Parental protein coverage: | 56.7 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSF |
| MALNKNHS.G.GVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPY.VIFLSKG.DAMQSF | |
| Retrocopy | MALNKNHSKGSGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYQVIFLSKGQDAMQSF |
| Parental | MMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFMAGGAIEFGQRMLQVASQASRGEAPN |
| MMPFYLMKD.EIKQPVFGANYI.GTVKAEAGGGW.GSAS.KLTFMAGGAIEFGQRMLQVASQASRGEAPN | |
| Retrocopy | MMPFYLMKDSEIKQPVFGANYINGTVKAEAGGGWGGSASCKLTFMAGGAIEFGQRMLQVASQASRGEAPN |
| Parental | GAYGYSYM |
| GAYGYSY. | |
| Retrocopy | GAYGYSYL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 6 .28 RPM |
| SRP051959_heart | 0 .00 RPM | 13 .40 RPM |
| SRP051959_kidney | 0 .00 RPM | 17 .82 RPM |
| SRP051959_liver | 0 .00 RPM | 9 .21 RPM |
| SRP051959_lung | 0 .02 RPM | 11 .79 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 7 .88 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 12 .71 RPM |
| SRP051959_spleen | 0 .00 RPM | 8 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000004946 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000037619 | 1 retrocopy |
retro_cjac_575 ,
|
| Felis catus | ENSFCAG00000005760 | 1 retrocopy | |
| Homo sapiens | ENSG00000132471 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009241 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000070 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009381 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000007725 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000013775 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001625 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006045 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008640 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000009660 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021421 | 2 retrocopies |