RetrogeneDB ID: | retro_cjac_3257 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:124064451..124064830(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTP4A2 | ||
| Ensembl ID: | ENSCJAG00000006539 | ||
| Aliases: | None | ||
| Description: | protein tyrosine phosphatase type IVA, member 2 [Source:HGNC Symbol;Acc:9635] |
| Percent Identity: | 67.44 % |
| Parental protein coverage: | 75.45 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | LVRVCDATYDKAPVEKEGIHVLDWPFDDGA-PPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGL-GRAP |
| LV.VCDAT....P.EKEGIH.L.WPF..GA..PPNQI.DDWL.LL.T.FRE.PGCCVAVHCV.GL.GR.. | |
| Retrocopy | LV*VCDATFGRIPAEKEGIHILHWPFNNGA<SPPNQIADDWLKLLSTDFREKPGCCVAVHCVVGL<GREG |
| Parental | VLVALALIECGMKY-EDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ |
| .L..L.L....M......V.F.R.KRR.AF.SKQLLYLEKYRPKMRL.FRDT.GHCCVQ | |
| Retrocopy | HLCWLHLL*LNMELCMKTVWFTRRKRRAAFYSKQLLYLEKYRPKMRLHFRDTDGHCCVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 117 .33 RPM |
| SRP051959_heart | 0 .05 RPM | 57 .99 RPM |
| SRP051959_kidney | 0 .04 RPM | 55 .69 RPM |
| SRP051959_liver | 0 .00 RPM | 46 .85 RPM |
| SRP051959_lung | 0 .00 RPM | 62 .14 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 60 .25 RPM |
| SRP051959_skeletal_muscle | 0 .09 RPM | 69 .73 RPM |
| SRP051959_spleen | 0 .02 RPM | 89 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000039121 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001743 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006539 | 2 retrocopies |
retro_cjac_3257 , retro_cjac_566,
|
| Homo sapiens | ENSG00000184007 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000028788 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002137 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002060 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029603 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001606 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000050044 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000003605 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002775 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000006790 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000016571 | 2 retrocopies |