RetrogeneDB ID: | retro_cjac_2965 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 7:18073624..18073995(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000013336 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.51 % |
| Parental protein coverage: | 59.81 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MTGAAFGAMNGLRLG-LKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAED |
| MT.AAFGA.NGLRL..LKETQNM.WSK.RNVQILNMVTRQGALW.NTLGSLA.L.SAFGVIIEKT.GAED | |
| Retrocopy | MTVAAFGALNGLRLD<LKETQNMVWSKSRNVQILNMVTRQGALWTNTLGSLAFLCSAFGVIIEKT*GAED |
| Parental | DLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL |
| DLNTVAAGTMT.M.YKCTGGL.GIARGGL.GLTLTSLYALYNNWE.M.GSLLQ.SL | |
| Retrocopy | DLNTVAAGTMTDM-YKCTGGL*GIARGGLIGLTLTSLYALYNNWEQMNGSLLQPSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 11 .67 RPM |
| SRP051959_heart | 0 .05 RPM | 16 .38 RPM |
| SRP051959_kidney | 0 .04 RPM | 19 .52 RPM |
| SRP051959_liver | 0 .04 RPM | 21 .27 RPM |
| SRP051959_lung | 0 .00 RPM | 10 .79 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 10 .23 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 29 .52 RPM |
| SRP051959_spleen | 0 .00 RPM | 11 .13 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007501 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000029477 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007073 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013336 | 1 retrocopy |
retro_cjac_2965 ,
|
| Cavia porcellus | ENSCPOG00000019917 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000002661 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000013701 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000525 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015393 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005255 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000015914 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019811 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000010335 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025276 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000007041 | 1 retrocopy |