RetrogeneDB ID: | retro_chof_613 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_12675:11581..11806(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSCHOG00000001228 | ||
| Aliases: | None | ||
| Description: | neural precursor cell expressed, developmentally down-regulated 8 [Source:HGNC Symbol;Acc:7732] |
| Percent Identity: | 54.67 % |
| Parental protein coverage: | 92.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | IKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLA |
| I.VKTLTGK.I.....P.D..E..K.....KE.IPP.QQRLI..GKQ..D..T..DY.I...S.LHLVL. | |
| Retrocopy | IFVKTLTGKTITLEVDPSDTIENVKAKIQDKEAIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR |
| Parental | LRGGS |
| LRGG. | |
| Retrocopy | LRGGA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
| Homo sapiens | ENSG00000129559 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |