RetrogeneDB ID: | retro_vpac_480 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | scaffold_2372:182254..182482(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSVPAG00000009104 | ||
| Aliases: | None | ||
| Description: | neural precursor cell expressed, developmentally down-regulated 8 [Source:HGNC Symbol;Acc:7732] |
| Percent Identity: | 53.95 % |
| Parental protein coverage: | 93.83 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MLIKVKTLTGKEIKNDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV |
| M.I.VKTLTGK.I....EP.D..E..K.....KEGIPP.QQ.LI..GKQ..D..T..DY.I...S.LHLV | |
| Retrocopy | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQCLIFVGKQLEDGRTLSDYNIQKESTLHLV |
| Parental | LALRGG |
| ..L.GG | |
| Retrocopy | RHL*GG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
| Homo sapiens | ENSG00000129559 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |