RetrogeneDB ID: | retro_chof_1602 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_336500:371..692(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MPHOSPH6 | ||
| Ensembl ID: | ENSCHOG00000000127 | ||
| Aliases: | None | ||
| Description: | M-phase phosphoprotein 6 [Source:HGNC Symbol;Acc:7214] |
| Percent Identity: | 78.5 % |
| Parental protein coverage: | 95.54 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | KKSFIIEEQSFMLCEDLLYGRMSFRGFNPDVEKLMLQMNAKNKAEDIEDETVELDVSDEEMARRYETLVG |
| ..SFIIE.QSFML.EDL.YGRMSFRGFNP.VEKLML.MNAKNKAED.EDETV.L.VS.EEMARRYETLVG | |
| Retrocopy | EESFIIEKQSFMLYEDLFYGRMSFRGFNP*VEKLML*MNAKNKAEDLEDETVYLNVSNEEMARRYETLVG |
| Parental | TIGEKFAKKRDHANYGEDDNGNLKPIKAKKMFLKTQD |
| .IG.KFAKKR..ANY.ED.NGN..P..AKKM.LK.QD | |
| Retrocopy | KIGKKFAKKRECANYEEDENGNI*PMEAKKMCLKLQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000127 | 2 retrocopies |
retro_chof_1602 , retro_chof_740,
|
| Callithrix jacchus | ENSCJAG00000016498 | 5 retrocopies | |
| Dipodomys ordii | ENSDORG00000011060 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000010276 | 6 retrocopies | |
| Homo sapiens | ENSG00000135698 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001405 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000580 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000268 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022575 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000031843 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010725 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000024341 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012532 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000007592 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008398 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050087 | 6 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013110 | 8 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001928 | 2 retrocopies |