RetrogeneDB ID: | retro_chof_1446 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_295746:318..771(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CLIC4 | ||
| Ensembl ID: | ENSCHOG00000007591 | ||
| Aliases: | None | ||
| Description: | chloride intracellular channel 4 [Source:HGNC Symbol;Acc:13518] |
| Percent Identity: | 77.12 % |
| Parental protein coverage: | 65.94 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLD-EYLNSPLPDEIDENSMEDI |
| .Y.KLSPKHPESNT..MDIFAKFSA.IKNS....NEALERGLLKTLQKLD....NSPL.DEI.ENSMEDI | |
| Retrocopy | QYVKLSPKHPESNTDRMDIFAKFSACIKNSSQRLNEALERGLLKTLQKLD<LIMNSPLRDEIHENSMEDI |
| Parental | KFSTRKFLDGNEMTLADCNLLPKLH-IVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV |
| .FST.KFLD.NEM.LADC..LPKL..IVKVV.KKY.NFDIP.G..G.WRY.TN.Y.RDEFTNTC.SDKEV | |
| Retrocopy | TFSTHKFLDSNEMILADCEFLPKLQ>IVKVVTKKYHNFDIP*GIAGMWRYFTNVYGRDEFTNTCSSDKEV |
| Parental | EIAYSDVAKRLTK |
| EI.YSD.AKRLTK | |
| Retrocopy | EIKYSDTAKRLTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007591 | 10 retrocopies |
retro_chof_1284, retro_chof_1401, retro_chof_1446 , retro_chof_1654, retro_chof_2177, retro_chof_2673, retro_chof_784, retro_chof_789, retro_chof_808, retro_chof_947,
|
| Callithrix jacchus | ENSCJAG00000020833 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000004010 | 1 retrocopy | |
| Homo sapiens | ENSG00000169504 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005586 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000008789 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002416 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000037242 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008997 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014620 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001715 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000350 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005838 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002184 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008978 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000007699 | 1 retrocopy |