RetrogeneDB ID: | retro_cfam_680 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 15:24674809..24675125(-) | ||
| Located in intron of: | ENSCAFG00000005914 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCAFG00000012395 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.7 % |
| Parental protein coverage: | 84.8 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVV-SERLKIRGS |
| KSAK.DKDPVNK.GGKAKKKKWSKGKV.DK.N.LVL.DKAT.DKLCKEVPN....T.....S.RLKI.G. | |
| Retrocopy | KSAKNDKDPVNKPGGKAKKKKWSKGKVWDKSNSLVLPDKATHDKLCKEVPNHE-LTTPAI>S*RLKIGGT |
| Parental | LARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAP |
| ..RAALQELLS..LIKLVSKHRAQVIYTR..KGG.AP | |
| Retrocopy | PVRAALQELLSEALIKLVSKHRAQVIYTRSAKGGNAP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 259 .09 RPM |
| SRP017611_brain | 0 .00 RPM | 78 .28 RPM |
| SRP017611_kidney | 0 .00 RPM | 747 .08 RPM |
| SRP017611_liver | 0 .00 RPM | 187 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000051 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000012395 | 3 retrocopies |
retro_cfam_500, retro_cfam_680 , retro_cfam_984,
|
| Cavia porcellus | ENSCPOG00000013298 | 2 retrocopies | |
| Felis catus | ENSFCAG00000001151 | 3 retrocopies | |
| Latimeria chalumnae | ENSLACG00000017531 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000017117 | 6 retrocopies | |
| Macropus eugenii | ENSMEUG00000014185 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000002687 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000004752 | 15 retrocopies | |
| Macaca mulatta | ENSMMUG00000016894 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000013334 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000004960 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000016194 | 9 retrocopies | |
| Sus scrofa | ENSSSCG00000015103 | 12 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000020783 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000000266 | 4 retrocopies |