RetrogeneDB ID: | retro_btau_952 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 21:32090305..32090640(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARPP19 | ||
| Ensembl ID: | ENSBTAG00000011022 | ||
| Aliases: | ARPP19, ARPP-16, ARPP-19 | ||
| Description: | cAMP-regulated phosphoprotein 19 [Source:UniProtKB/Swiss-Prot;Acc:Q28055] |
| Percent Identity: | 90.43 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK-LKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAK |
| MSAEVP.AASAEEQKEMEDKV.SPEKAEEAK.LKARYPHLGQ.PGGSDFL.KRL.KG.KYFDSGDYNMAK | |
| Retrocopy | MSAEVPQAASAEEQKEMEDKVISPEKAEEAK>LKARYPHLGQNPGGSDFLSKRLHKG*KYFDSGDYNMAK |
| Parental | A-KMKNKQLPTATPDKTEVTGDHI-PTPQDLPQRKPSLVASKLAG |
| A.KMKNKQLPTATPDKTEVTGD.I.PTPQDLPQ.KPSLVASKLAG | |
| Retrocopy | A<KMKNKQLPTATPDKTEVTGDYI<PTPQDLPQWKPSLVASKLAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 23 .86 RPM |
| ERP005899_muscle | 0 .00 RPM | 20 .22 RPM |
| SRP017611_brain | 0 .00 RPM | 122 .97 RPM |
| SRP017611_kidney | 0 .00 RPM | 48 .78 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .74 RPM |
| SRP030211_testis | 0 .00 RPM | 83 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011022 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000032515 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000011228 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004474 | 9 retrocopies | |
| Dipodomys ordii | ENSDORG00000011321 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015550 | 1 retrocopy | |
| Homo sapiens | ENSG00000128989 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025250 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006551 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000015489 | 10 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013865 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006487 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000042183 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000004618 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003677 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004804 | 1 retrocopy |