RetrogeneDB ID: | retro_btau_418 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 11:5928514..5928732(-) | ||
| Located in intron of: | ENSBTAG00000019697 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TXN | ||
| Ensembl ID: | ENSBTAG00000002953 | ||
| Aliases: | None | ||
| Description: | Thioredoxin [Source:UniProtKB/Swiss-Prot;Acc:O97680] |
| Percent Identity: | 70.27 % |
| Parental protein coverage: | 75.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | GPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKE-KLEATI |
| G.CKMIK.F.HSLSEK.SNV.FL..DV...QD.A..CE.KC.PTF..FKKGQKVGEFSG...E.KLEATI | |
| Retrocopy | GTCKMIKAFSHSLSEKCSNVLFLKADVNGHQDAASQCEAKCTPTF*LFKKGQKVGEFSGVTRE<KLEATI |
| Parental | NELI |
| .ELI | |
| Retrocopy | HELI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 77 .43 RPM |
| ERP005899_muscle | 0 .05 RPM | 102 .57 RPM |
| SRP017611_brain | 0 .00 RPM | 13 .52 RPM |
| SRP017611_kidney | 0 .06 RPM | 48 .37 RPM |
| SRP017611_liver | 0 .00 RPM | 106 .54 RPM |
| SRP030211_testis | 0 .00 RPM | 10 .75 RPM |