RetrogeneDB ID: | retro_btau_1702 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 9:45705210..45705590(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF4E | ||
| Ensembl ID: | ENSBTAG00000009522 | ||
| Aliases: | None | ||
| Description: | Eukaryotic translation initiation factor 4E [Source:UniProtKB/Swiss-Prot;Acc:Q9N0T5] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 58.06 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | EKTESNQEVANPEHYIKHPLQNRWALW-FFKNDKSKTWQ-ANLRLISKFDTVEDFWALYNHIQLSSNLMP |
| EK.E..QEVANPE.Y.KHPLQNRWALW.F.K..K.K....ANL.LISKFDT.E.FWALYNHIQL.SNLM. | |
| Retrocopy | EKREIYQEVANPEQYMKHPLQNRWALW>FLKMIKAKLGK>ANLQLISKFDTLEGFWALYNHIQLPSNLMS |
| Parental | GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETVLCLIGESFDDY |
| .C.YSLFKDGI.PMW.DEKNK.GG.WLITLNKQQR.SDL.RFWL...L.LI.ESFDDY | |
| Retrocopy | SCEYSLFKDGIKPMWKDEKNKQGG*WLITLNKQQR*SDLNRFWLQMLLYLIEESFDDY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 41 .38 RPM |
| ERP005899_muscle | 0 .00 RPM | 40 .59 RPM |
| SRP017611_brain | 0 .00 RPM | 33 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 48 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 21 .07 RPM |
| SRP030211_testis | 0 .00 RPM | 96 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003103 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000009522 | 3 retrocopies |
retro_btau_1094, retro_btau_1702 , retro_btau_944,
|
| Bos taurus | ENSBTAG00000010598 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000010307 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000009450 | 9 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013712 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000007347 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000011104 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000005035 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000020716 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002041 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001131 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004206 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006072 | 3 retrocopies | |
| Drosophila melanogaster | FBgn0035709 | 1 retrocopy |