RetrogeneDB ID: | retro_btau_1695 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 9:13988964..13989205(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ACP1 | ||
| Ensembl ID: | ENSBTAG00000020498 | ||
| Aliases: | None | ||
| Description: | Low molecular weight phosphotyrosine protein phosphatase [Source:UniProtKB/Swiss-Prot;Acc:P11064] |
| Percent Identity: | 69.14 % |
| Parental protein coverage: | 50.63 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | QVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWRIDSAATSTYELGNPPDF-RGQACMRKHGIPMS |
| Q..K.VLFVCLGNI..SPIAEAVFRK.VTDQ.ISD.WR...A.T..YELGNPPD..RGQA.M.KH..PMS | |
| Retrocopy | QMIKLVLFVCLGNISLSPIAEAVFRKPVTDQTISDSWRRGHALTTMYELGNPPDY>RGQASMKKHDSPMS |
| Parental | HVARQVTKEDF |
| H.A.Q.T..DF | |
| Retrocopy | HIAPQIT*NDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 28 .33 RPM |
| ERP005899_muscle | 0 .00 RPM | 35 .58 RPM |
| SRP017611_brain | 0 .00 RPM | 42 .07 RPM |
| SRP017611_kidney | 0 .00 RPM | 45 .05 RPM |
| SRP017611_liver | 0 .00 RPM | 27 .86 RPM |
| SRP030211_testis | 0 .00 RPM | 89 .93 RPM |