RetrogeneDB ID: | retro_btau_1053 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 24:54143574..54143807(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SEC61B | ||
| Ensembl ID: | ENSBTAG00000002457 | ||
| Aliases: | None | ||
| Description: | protein transport protein Sec61 subunit beta [Source:RefSeq peptide;Acc:NP_001068760] |
| Percent Identity: | 61.73 % |
| Parental protein coverage: | 81.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | PAPSGTNV-GSSGRSPSK-AVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGG-MWRFYTEDSPGLKVGP |
| P..SGTN..GSSG.S..K.A.A..AAGSTV.Q.K.AS.G.R..G.TTS.GT.G....FY.EDSPGL.VGP | |
| Retrocopy | PVFSGTNG<GSSGHSLTK<AGATWAAGSTVQQTKSASWGVRGTGLTTSGGTQG>LRQFYPEDSPGLEVGP |
| Parental | VPVLVMSLLFI |
| VP.LV.SLL.. | |
| Retrocopy | VPALVTSLLYL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 44 .05 RPM |
| ERP005899_muscle | 0 .05 RPM | 79 .50 RPM |
| SRP017611_brain | 0 .00 RPM | 11 .19 RPM |
| SRP017611_kidney | 0 .00 RPM | 43 .98 RPM |
| SRP017611_liver | 0 .00 RPM | 126 .55 RPM |
| SRP030211_testis | 0 .00 RPM | 24 .64 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002457 | 3 retrocopies |
retro_btau_1053 , retro_btau_360, retro_btau_791,
|
| Callithrix jacchus | ENSCJAG00000011279 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026930 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005293 | 4 retrocopies | |
| Homo sapiens | ENSG00000106803 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004205 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000321 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011121 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001097 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010661 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000053317 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017055 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004168 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000019441 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021184 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000006345 | 1 retrocopy |