RetrogeneDB ID: | retro_amel_1829 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL194637.1:67486..67907(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5G3 | ||
| Ensembl ID: | ENSAMEG00000012367 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Source:HGNC Symbol;Acc:843] |
| Percent Identity: | 61.11 % |
| Parental protein coverage: | 94.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | KMFACAKLACTPALIRAGSRVAYRPISASVL-SRPEARTGEGSTVFNGAQNGVSQLIQRE-FQTSAISRD |
| K..ACA.....P...R..S.......S..VL...PE..T.E.......A.N....LI....F.TS.ISRD | |
| Retrocopy | KLDACA*FVSAPFFVRSTSPLSSCSLSVVVL>NHPETLTDESLSSL-AATNPLTSLILNH>F*TSVISRD |
| Parental | IDTAAKFIGAGAATVG-VAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFL |
| ..TAA.F.GAGAA.VG.VAGSGAGIGTVFGSLIIGY.RNPSL.QQLFSYAILG.AL.EAMGLFCLMVAF. | |
| Retrocopy | VGTAAEFAGAGAARVG<VAGSGAGIGTVFGSLIIGYGRNPSLQQQLFSYAILGCALLEAMGLFCLMVAFI |
| Parental | ILFA |
| ILFA | |
| Retrocopy | ILFA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000619 | 18 retrocopies | |
| Ailuropoda melanoleuca | ENSAMEG00000012367 | 1 retrocopy |
retro_amel_1829 ,
|
| Canis familiaris | ENSCAFG00000013366 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000012592 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000008207 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000006194 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010440 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000010768 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012822 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003954 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009520 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000013986 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012164 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027578 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000001596 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006733 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013572 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000012159 | 1 retrocopy |