RetrogeneDB ID: | retro_tsyr_151 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | GeneScaffold_3921:32269..32506(-) | ||
| Located in intron of: | ENSTSYG00000000219 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBE2B | ||
| Ensembl ID: | ENSTSYG00000011148 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2B [Source:HGNC Symbol;Acc:12473] |
| Percent Identity: | 53.01 % |
| Parental protein coverage: | 54.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | IEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQA |
| .EF...YP...PTV.FL....HPNV...G.ICLDIL...WS..YD...IL.SIQSLL.EPN..SP....A | |
| Retrocopy | LEFPRGYPYNAPTVKFLMLCYHPNVDTQGNICLDILKD*WSVLYD---ILLSIQSLLGEPNIHSPLSTHA |
| Parental | AQLYQENKREYEK |
| AQL...N.R...K | |
| Retrocopy | AQLW-KNPRAFKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |