RetrogeneDB ID: | retro_tsyr_1104 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_306725:1517..1736(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RNASEK | ||
| Ensembl ID: | ENSTSYG00000006902 | ||
| Aliases: | None | ||
| Description: | ribonuclease, RNase K [Source:HGNC Symbol;Acc:33911] |
| Percent Identity: | 76.71 % |
| Parental protein coverage: | 74.49 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | CGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPLTEKDFENGPQNIYSVYEQVSYNCFIAASLY |
| CGPKLAAC..VLSAWG.I.L.MLGIF.NVHSAVL.EDV.LTE.DFENGPQN....YE..S.NCFIAA.LY | |
| Retrocopy | CGPKLAACILVLSAWGAIRLTMLGIFLNVHSAVLVEDVHLTEEDFENGPQNTDNIYEHASHNCFIAAGLY |
| Parental | LLL |
| LLL | |
| Retrocopy | LLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000004064 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000023883 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006902 | 2 retrocopies |
retro_tsyr_1104 , retro_tsyr_1737,
|