RetrogeneDB ID: | retro_tbel_4115 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_6779:4082..4292(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMGT1 | ||
| Ensembl ID: | ENSTBEG00000011209 | ||
| Aliases: | None | ||
| Description: | membrane magnesium transporter 1 [Source:HGNC Symbol;Acc:28100] |
| Percent Identity: | 75.71 % |
| Parental protein coverage: | 53.44 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | GIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKT |
| G.GLFAL.H.AFS.A.H.S.M.LTEKE..SLPI.IVL.TLLAF.VTCYG.VHIAGE.KDM.ATSELKN.T | |
| Retrocopy | GTGLFALGHTAFSMA*HHSDM*LTEKEAQSLPIYIVL*TLLAFVVTCYGTVHIAGELKDMNATSELKNTT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000025297 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000013476 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000005810 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028393 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000061273 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029505 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003462 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000881 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025854 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004796 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011209 | 1 retrocopy |
retro_tbel_4115 ,
|