RetrogeneDB ID: | retro_btau_864 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 2:39142481..39142780(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMGT1 | ||
| Ensembl ID: | ENSBTAG00000025297 | ||
| Aliases: | MMGT1, TMEM32 | ||
| Description: | membrane magnesium transporter 1 precursor [Source:RefSeq peptide;Acc:NP_001073098] |
| Percent Identity: | 90.1 % |
| Parental protein coverage: | 60.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | RLTEKEDESLPIDIVLQTLLAF-AVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVL |
| ...EKEDESLPIDIVLQTLLA..AVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNH.GRVL | |
| Retrocopy | KTSEKEDESLPIDIVLQTLLAW<AVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHHGRVL |
| Parental | FRPSDTTNSSNQDALSSNTSLKLRKLESLRR |
| FRPSDTT.SSNQDA.SSNTSLKL.KLESL.R | |
| Retrocopy | FRPSDTTSSSNQDASSSNTSLKLQKLESLHR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 2 .31 RPM |
| ERP005899_muscle | 0 .00 RPM | 3 .96 RPM |
| SRP017611_brain | 0 .00 RPM | 3 .24 RPM |
| SRP017611_kidney | 0 .00 RPM | 5 .63 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .62 RPM |
| SRP030211_testis | 0 .00 RPM | 4 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000025297 | 2 retrocopies |
retro_btau_1566, retro_btau_864 ,
|
| Cavia porcellus | ENSCPOG00000013476 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000005810 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028393 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000061273 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029505 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003462 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000881 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025854 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004796 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011209 | 1 retrocopy |