RetrogeneDB ID: | retro_tbel_3429 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_140158:147851..148077(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTBEG00000001443 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.92 % |
| Parental protein coverage: | 92.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SLLQAALLCVNAIAVLHEERFLKNIGWATDQGIGGFGEEPGI-KSQLMNLIRSVRTVMRVPLIIVNSVAI |
| SLLQ.ALLCV.A..VLH.E.F.KNIGW...QGIGGFGEEPGI.K.QLMNLI.SVR..MRVPLIIVNS.A. | |
| Retrocopy | SLLQVALLCVIAMMVLHKEHF-KNIGWGIAQGIGGFGEEPGI>KFQLMNLIWSVRAMMRVPLIIVNSIAV |
| Parental | VLLLLFG |
| VLLLLFG | |
| Retrocopy | VLLLLFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
| Homo sapiens | ENSG00000134049 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |