RetrogeneDB ID: | retro_tbel_1543 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_5041:59993..60201(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HRSP12 | ||
| Ensembl ID: | ENSTBEG00000002602 | ||
| Aliases: | None | ||
| Description: | heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897] |
| Percent Identity: | 62.5 % |
| Parental protein coverage: | 71.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | PYSQAVVVDRTVYVSGQLGINPSSGQL-VPG-GVAEEAKQALINMGEILKAASCDYSNVVKTTVLLADIN |
| PYS.A.....T.Y.SGQLGIN.SS.QL..PG..V.EEAK.AL.NM..ILK.ASCD....VKT.VLL.DI. | |
| Retrocopy | PYSEAMLIHGTIYISGQLGINSSSRQL<APG<AVVEEAKPALKNMSKILKVASCDRTHSVKTIVLLTDIS |
| Parental | DF |
| DF | |
| Retrocopy | DF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030250 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001278 | 8 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015560 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025138 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014805 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001185 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002078 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011825 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000006575 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000022323 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000021532 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001465 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000011452 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000002602 | 10 retrocopies |
retro_tbel_1543 , retro_tbel_1602, retro_tbel_2450, retro_tbel_2868, retro_tbel_2995, retro_tbel_3589, retro_tbel_421, retro_tbel_621, retro_tbel_888, retro_tbel_953,
|