RetrogeneDB ID: | retro_sscr_944 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 7:84473847..84474237(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000017352 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.71 % |
| Parental protein coverage: | 59.11 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 3 |
| Parental | VTTKVKK-EDEVQAIATLI-EKQAQIVVKPRMVSEEEKQRKAALLAQYADVTDEEQWEADEKDDSGASTM |
| V.T.V.K.EDEVQ..AT...EKQA.I..KPR.VSEEEKQR.AA.LA.YADV.D.....ADEK.D.....M | |
| Retrocopy | VVTTVNK<EDEVQVVATFM<EKQA*IMMKPRIVSEEEKQREAAPLAMYADV*DKDN-KADEK-DDSGEAM |
| Parental | -NLGSDKSLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKEKEKKRTQRGE |
| ...GS.KSL..NT.VEDV..A.KLE.DSL.DESQRKKE.DKLQ.ERDKL.K.E.KEK.KKRT.R.E | |
| Retrocopy | <DEGSGKSLLQNTHVEDVPSAGKLEQDSLWDESQRKKE*DKLQKERDKLTKEECKEKNKKRTERRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 2 .79 RPM |
| SRP014902_testis | 0 .00 RPM | 8 .49 RPM |
| SRP018288_heart | 0 .00 RPM | 10 .50 RPM |
| SRP018288_kidney | 0 .00 RPM | 11 .33 RPM |
| SRP018288_liver | 0 .00 RPM | 4 .80 RPM |
| SRP018288_lung | 0 .00 RPM | 11 .10 RPM |
| SRP018856_adipose | 0 .03 RPM | 11 .05 RPM |
| SRP035408_brain | 0 .00 RPM | 21 .50 RPM |
| SRP035408_liver | 0 .00 RPM | 12 .27 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000018379 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000014115 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011411 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000009224 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017526 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006793 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000002748 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017352 | 2 retrocopies |
retro_sscr_173, retro_sscr_944 ,
|