RetrogeneDB ID: | retro_sscr_841 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:57092661..57092986(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TYMS | ||
| Ensembl ID: | ENSSSCG00000023869 | ||
| Aliases: | None | ||
| Description: | thymidylate synthetase [Source:HGNC Symbol;Acc:12441] |
| Percent Identity: | 76.58 % |
| Parental protein coverage: | 66.87 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | VVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPG-DFVHTLGDAHIYLNHIEPLKIQLQR |
| ..N.ELS.QLYQ.SGDMGLGV.FNIASY.LLTYMI.HITGLKP..DF.HT.G.A.I.LN.IEPLKI.LQ. | |
| Retrocopy | LLNRELSYQLYQESGDMGLGVHFNIASYPLLTYMIPHITGLKP*<DFEHTSGHARIGLNRIEPLKIELQ* |
| Parental | EPRPFPKLKILRKVEKIDDFKAEDFQIEGYN-PHPTIKMEM |
| .PRPFPKLKIL.KVEKI.DFK.EDF.IEGYN.P.PTIK.EM | |
| Retrocopy | GPRPFPKLKIL*KVEKINDFKTEDFYIEGYN<PYPTIKIEM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 1 .46 RPM |
| SRP014902_testis | 0 .00 RPM | 9 .48 RPM |
| SRP018288_heart | 0 .00 RPM | 1 .07 RPM |
| SRP018288_kidney | 0 .00 RPM | 0 .99 RPM |
| SRP018288_liver | 0 .00 RPM | 1 .92 RPM |
| SRP018288_lung | 0 .00 RPM | 2 .95 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .68 RPM |
| SRP035408_brain | 0 .00 RPM | 0 .25 RPM |
| SRP035408_liver | 0 .00 RPM | 2 .67 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Loxodonta africana | ENSLAFG00000014910 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000009507 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000021479 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000025747 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024349 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000003102 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023869 | 2 retrocopies |
retro_sscr_810, retro_sscr_841 ,
|