RetrogeneDB ID: | retro_sscr_603 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 18:53180549..53180884(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ARPP19 | ||
| Ensembl ID: | ENSSSCG00000004618 | ||
| Aliases: | ARPP-19, Arpp19 | ||
| Description: | Sus scrofa cAMP-regulated phosphoprotein (ARPP-19), mRNA. [Source:RefSeq mRNA;Acc:NM_214175] |
| Percent Identity: | 75.22 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLK-ARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAK |
| MS...PEAAS.EEQKEMEDKV.SPEK.EEA.LK.AR..HLGQKPGGS.FLRK.LQKGQ.Y..SGDY..AK | |
| Retrocopy | MSVGAPEAASTEEQKEMEDKVMSPEKTEEATLK<ARCSHLGQKPGGSGFLRK*LQKGQQYSESGDYSVAK |
| Parental | AKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG |
| AK.KNKQ.P.A..DKTE.T.DHIPT.Q.LPQ.KPSL.ASKLAG | |
| Retrocopy | AKTKNKQSPSATQDKTEATRDHIPTWQELPQQKPSLAASKLAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 13 .54 RPM |
| SRP014902_testis | 0 .00 RPM | 26 .45 RPM |
| SRP018288_heart | 0 .00 RPM | 74 .05 RPM |
| SRP018288_kidney | 0 .00 RPM | 60 .58 RPM |
| SRP018288_liver | 0 .00 RPM | 18 .87 RPM |
| SRP018288_lung | 0 .10 RPM | 69 .95 RPM |
| SRP018856_adipose | 0 .00 RPM | 34 .73 RPM |
| SRP035408_brain | 0 .00 RPM | 86 .01 RPM |
| SRP035408_liver | 0 .00 RPM | 14 .91 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011022 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000032515 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000011228 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004474 | 9 retrocopies | |
| Dipodomys ordii | ENSDORG00000011321 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015550 | 1 retrocopy | |
| Homo sapiens | ENSG00000128989 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025250 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006551 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000015489 | 10 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013865 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006487 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000042183 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000004618 | 1 retrocopy |
retro_sscr_603 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000003677 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004804 | 1 retrocopy |