RetrogeneDB ID: | retro_dnov_557 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_6133:58137..58470(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ARPP19 | ||
| Ensembl ID: | ENSDNOG00000004474 | ||
| Aliases: | None | ||
| Description: | cAMP-regulated phosphoprotein, 19kDa [Source:HGNC Symbol;Acc:16967] |
| Percent Identity: | 58.56 % |
| Parental protein coverage: | 98.21 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | SAEIPEAASAEEQKEMEDKVTSPEKAEE-AKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKA |
| S........A.E......K....E..EE.AKLKA..P..GQKPGGSD.LRK.L.KGQK.FDSGD....KA | |
| Retrocopy | SSACGRGSGAAESPQAASKEGQKEMEEEGAKLKAGHPPGGQKPGGSDSLRK*LKKGQKCFDSGDCDISKA |
| Parental | KMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLA |
| KM.NK.LPTA.P.KT...GDH.P.P.D.PQRKPSL.ASKLA | |
| Retrocopy | KMRNKPLPTATPAKTGAPGDHVPRPRDPPQRKPSLAASKLA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 19 .45 RPM |
| SRP012922_cerebellum | 2 .06 RPM | 18 .28 RPM |
| SRP012922_heart | 0 .00 RPM | 13 .23 RPM |
| SRP012922_kidney | 0 .00 RPM | 9 .31 RPM |
| SRP012922_liver | 0 .31 RPM | 8 .36 RPM |
| SRP012922_lung | 0 .15 RPM | 21 .08 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 70 .62 RPM |
| SRP012922_spleen | 0 .80 RPM | 30 .79 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011022 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000032515 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000011228 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004474 | 9 retrocopies |
retro_dnov_1086, retro_dnov_1576, retro_dnov_1960, retro_dnov_2150, retro_dnov_2427, retro_dnov_557 , retro_dnov_616, retro_dnov_644, retro_dnov_662,
|
| Dipodomys ordii | ENSDORG00000011321 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015550 | 1 retrocopy | |
| Homo sapiens | ENSG00000128989 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025250 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006551 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000015489 | 10 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013865 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006487 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000042183 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000004618 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003677 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004804 | 1 retrocopy |