RetrogeneDB ID: | retro_sscr_181 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:141418919..141419333(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RNF4 | ||
| Ensembl ID: | ENSSSCG00000008690 | ||
| Aliases: | None | ||
| Description: | ring finger protein 4 [Source:HGNC Symbol;Acc:10067] |
| Percent Identity: | 52.45 % |
| Parental protein coverage: | 74.21 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | MSTRKRRGGAVNSRQA-QKRTRESPST-PEMALEAEPIELVESAGDEIVDLTCESLEPVVVDLTHNDSVV |
| M.T....G..V.SR.....RT....ST.PE..LEAE..EL.ES..DEIV.LTCESLEP.V.DLTH..SVV | |
| Retrocopy | MNTKMSYGTRVKSR*T*EFRTAGIGSTIPEVILEAELLELGES--DEIVNLTCESLEPAVIDLTHHESVV |
| Parental | IVEERRRPRRNARRLRQDHADSCVVSSDDEELSRDRDVYVTTQTPRNAREEAATGLRPSGTVSCPICMDG |
| I.EERRR.R.N.....Q....SC.V.SD.E.L.RDRDVYVT.....NA.EE........G.....IC..G | |
| Retrocopy | ITEERRRSRGNT--CFQGQTGSC-VGSDKEGLMRDRDVYVTNSAYHNALEEKTLNGSVPGYIWY*ICKYG |
| Parental | YSE |
| YSE | |
| Retrocopy | YSE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 48 .71 RPM |
| SRP014902_testis | 0 .00 RPM | 58 .84 RPM |
| SRP018288_heart | 0 .00 RPM | 23 .42 RPM |
| SRP018288_kidney | 0 .00 RPM | 53 .09 RPM |
| SRP018288_liver | 0 .00 RPM | 35 .02 RPM |
| SRP018288_lung | 0 .00 RPM | 66 .19 RPM |
| SRP018856_adipose | 0 .00 RPM | 76 .11 RPM |
| SRP035408_brain | 0 .00 RPM | 37 .92 RPM |
| SRP035408_liver | 0 .00 RPM | 30 .94 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1144 |
| Pongo abelii | retro_pabe_1240 |
| Canis familiaris | retro_cfam_25 |
| Equus caballus | retro_ecab_33 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014366 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000014856 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000006675 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024877 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001683 | 3 retrocopies | |
| Felis catus | ENSFCAG00000004051 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007382 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000005969 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000160 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004998 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004317 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000004528 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025865 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000008690 | 1 retrocopy |
retro_sscr_181 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000011101 | 2 retrocopies |